missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMP-9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 498.00
Specifications
| Antigen | MMP-9 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695565
|
Novus Biologicals
NBP2-39011-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18136518
|
Novus Biologicals
NBP2-39011 |
0.1 mL |
€ 498.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MMP-9 Polyclonal specifically detects MMP-9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MMP-9 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Cancer, Cellular Markers, Extracellular Matrix, GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 92 kDa gelatinase, 92 kDa type IV collagenase, CLG4B, EC 3.4.24, EC 3.4.24.35, Gelatinase B, GELB, macrophage gelatinase, MANDP2, matrix metallopeptidase 9, matrix metalloproteinase 9, matrix metalloproteinase-9, MMP-9, type V collagenase | |
| MMP9 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P14780 | |
| 4318 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title