missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOCS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38359
This item is not returnable.
View return policy
Description
MOCS2 Polyclonal specifically detects MOCS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MOCS2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| O96007 | |
| MOCS2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.-, MCBPE, MOCO1-A, MOCO1-B, MOCO1MOCS2B, MOCS2A, molybdenum cofactor biosynthesis protein E, molybdenum cofactor synthesis 2, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2 small subunit, Molybdenum cofactor synthesis protein 2A, Molybdenum cofactor synthesis protein 2B, molybdopterin synthase catalytic subunit, molybdopterin synthase sulfur carrier subunit, Molybdopterin-synthase large subunit, Molybdopterin-synthase small subunit, MPT synthase large subunit, MPTS, Sulfur carrier protein MOCS2A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 4338 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction