missing translation for 'onlineSavingsMsg'
Learn More

MOK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-81042-25ul

View more versions of this product

Product Code. 18416060

€ 433.00 / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

MOK Polyclonal antibody specifically detects MOK in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	MOK
Classification	Polyclonal
Dilution	Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Gene Accession No.	Q9UQ07
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunocytochemistry
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol
Gene Alias	EC 2.7.11.22, MAPK/MAK/MRK overlapping kinase, MOK Protein Kinase, RAGE, RAGE1, RAGE-1, renal cell carcinoma antigen, Renal tumor antigen 1, STK30
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: KQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDL
Quantity	25 μL
Research Discipline	Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Kinase, Vision
Gene ID (Entrez)	5891
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

MOK Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions