missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Monoamine Oxidase B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59569
This item is not returnable.
View return policy
Description
Monoamine Oxidase B Polyclonal specifically detects Monoamine Oxidase B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Monoamine Oxidase B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| adrenalin oxidase, amine oxidase [flavin-containing] B, EC 1.4.3, EC 1.4.3.4, MAO, brain, MAO, platelet, MAO-B, MGC26382, monoamine oxidase B, Monoamine oxidase type B, tyramine oxidase | |
| Rabbit | |
| 59 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| P27338 | |
| MAOB | |
| Synthetic peptides corresponding to MAOB(monoamine oxidase B) The peptide sequence was selected from the N terminal of MAOB. Peptide sequence RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV. | |
| Affinity purified | |
| RUO | |
| 4129 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction