missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Motilin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93868-0.1ml
This item is not returnable.
View return policy
Description
Motilin Polyclonal antibody specifically detects Motilin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Motilin | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:100, Immunohistochemistry-Paraffin | |
| MGC138519, motilin, prepromotilin, promotilin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1). FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK | |
| 0.1 mL | |
| Signal Transduction | |
| 4295 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction