missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMDEC1, Mouse, Polyclonal Antibody, Abnova™
Description
This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq
Sequence: PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
Specifications
Specifications
| Antigen | ADAMDEC1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Mouse polyclonal antibody raised against a partial recombinant ADAMDEC1. |
| Formulation | 50% glycerol |
| Gene | ADAMDEC1 |
| Gene Accession No. | NM_014479 |
| Gene Alias | M12.219 |
| Gene Symbols | ADAMDEC1 |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?