missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16182307

ARX, Mouse, Clone: 4C12, Abnova™

Product Code. 16182307
Change view
Click to view available options
Quantity:
200 μL
Unit Size:
200µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16182307 200 μL 200µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16182307 Supplier Abnova Supplier No. H00170302M05A.200uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant ARX.

This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq

Sequence: MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR

Specifications

Antigen ARX
Applications ELISA
Classification Monoclonal
Clone 4C12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ARX.
Formulation ascites with no preservative
Gene ARX
Gene Accession No. NM_139058
Gene Alias ISSX/MRX29/MRX32/MRX33/MRX36/MRX38/MRX43/MRX54/MRX76/MRX87/MRXS1/PRTS
Gene Symbols ARX
Host Species Mouse
Immunogen ARX (NP_620689,1 a.a. ∽ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 170302
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.