missing translation for 'onlineSavingsMsg'
Learn More

BAG2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BAG2.

Brand: Abnova H00009532-A01.50uL

Product Code. 16180876

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq

Sequence: RNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN

Specifications

Antigen	BAG2
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant BAG2.
Gene	BAG2
Gene Alias	BAG-2/KIAA0576/MGC149462/dJ417I1.2
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_004282
Gene Symbols	BAG2
Immunogen	BAG2 (NP_004273, 102 a.a. to 211 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	9532
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

BAG2, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions