missing translation for 'onlineSavingsMsg'
Learn More

BTBD9 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Product Code. 16121407
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16121407 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16121407 Supplier Abnova Supplier No. H00114781A01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse polyclonal antibody raised against a partial recombinant BTBD9.

Sequence: RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN

Specifications

Antigen BTBD9
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant BTBD9.
Formulation 50% glycerol
Gene BTBD9
Gene Accession No. NM_152733
Gene Alias FLJ32945/KIAA1880/MGC120517/MGC120519/MGC120520/dJ322I12.1
Gene Symbols BTBD9
Host Species Mouse
Immunogen BTBD9 (NP_689946, 2 a.a. to 70 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 114781
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.