missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16158925

EIF4EBP3, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16158925
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16158925 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16158925 Supplier Abnova Supplier No. H00008637A01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant EIF4EBP3.

This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq

Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Specifications

Antigen EIF4EBP3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant EIF4EBP3.
Formulation 50% glycerol
Gene EIF4EBP3
Gene Accession No. NM_003732
Gene Alias 4E-BP3
Gene Symbols EIF4EBP3
Host Species Mouse
Immunogen EIF4EBP3 (NP_003723, 1 a.a. to 100 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8637
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.