missing translation for 'onlineSavingsMsg'
Learn More

ERBB2IP, Mouse, Clone: 10G1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ERBB2IP.

Brand: Abnova H00055914-M01A.200uL

Product Code. 16158526

€ 349.00 / 200µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date. [provided by RefSeq

Sequence: QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Specifications

Antigen	ERBB2IP
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	ascites with no preservative
Gene Accession No.	NM_018695
Gene Symbols	ERBB2IP
Immunogen	ERBB2IP (NP_061165,1272 a.a. ∽ 1371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	55914
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Ascites

Applications	ELISA, Western Blot
Clone	10G1
Description	Mouse monoclonal antibody raised against a partial recombinant ERBB2IP.
Gene	ERBB2IP
Gene Alias	ERBIN/LAP2
Host Species	Mouse
Quantity	200 μL
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2a κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

ERBB2IP, Mouse, Clone: 10G1, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions