missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16140127

FLJ23577, Mouse, Clone: 4B10, Abnova™

Product Code. 16140127
Change view
Click to view available options
Quantity:
200 μL
Unit Size:
200µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16140127 200 μL 200µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16140127 Supplier Abnova Supplier No. H00079925M01A.200uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant FLJ23577.

Sequence: AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY

Specifications

Antigen FLJ23577
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4B10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FLJ23577.
Formulation ascites with no preservative
Gene SPEF2
Gene Accession No. NM_024867
Gene Alias FLJ23164/FLJ23577/FLJ25395/KIAA1770/KPL2/MGC102842
Gene Symbols SPEF2
Host Species Mouse
Immunogen FLJ23577 (NP_079143,324 a.a. ∽ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79925
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.