missing translation for 'onlineSavingsMsg'
Learn More

GBE1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GBE1.

Brand: Abnova H00002632-A01.50uL

Product Code. 16168564

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease). [provided by RefSeq]

Sequence: SEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Specifications

Antigen	GBE1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant GBE1.
Gene	GBE1
Gene Alias	GBE
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_000158
Gene Symbols	GBE1
Immunogen	GBE1 (NP_000149, 605 a.a. to 702 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	2632
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

GBE1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions