missing translation for 'onlineSavingsMsg'
Learn More

GLYATL2, Mouse, Clone: 1C5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant GLYATL2.

Brand: Abnova H00219970-M03.100ug

Product Code. 16147079

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC

Specifications

Antigen	GLYATL2
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC016789.1
Gene Symbols	GLYATL2
Immunogen	GLYATL2 (AAH16789.1,1 a.a. ∽ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Applications	ELISA, Western Blot
Clone	1C5
Description	Mouse monoclonal antibody raised against a full-length recombinant GLYATL2.
Gene	GLYATL2
Gene Alias	BXMAS2-10/GATF-B/MGC24009
Host Species	Mouse
Purification Method	Protein A Purification
Regulatory Status	RUO
Gene ID (Entrez)	219970
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

GLYATL2, Mouse, Clone: 1C5, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions