missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16116645

KLF10, Mouse, Clone: 3F1, Abnova™

Código de producto. 16116645
Change view
Click to view available options
Quantity:
100 μg
Tamaño de la unidad:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
16116645 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16116645 Proveedor Abnova N.º de proveedor H00007071M49.100ug

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS

Especificaciones

Antigen KLF10
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant KLF10.
Formulation PBS with no preservative; pH 7.4
Gene KLF10
Gene Accession No. BC011538.1
Gene Alias EGRA/TIEG/TIEG1
Gene Symbols KLF10
Host Species Mouse
Immunogen KLF10 (AAH11538.1,1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7071
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2a κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.