missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16118004

MS4A2, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16118004
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16118004 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16118004 Supplier Abnova Supplier No. H00002206A01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant MS4A2.

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms

Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE

Specifications

Antigen MS4A2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant MS4A2.
Formulation 50% glycerol
Gene MS4A2
Gene Accession No. NM_000139
Gene Alias APY/ATOPY/FCER1B/FCERI/IGEL/IGER/IGHER/MS4A1
Gene Symbols MS4A2
Host Species Mouse
Immunogen MS4A2 (NP_000130, 1 a.a. ∽ 59 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2206
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.