missing translation for 'onlineSavingsMsg'
Learn More

PAXIP1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PAXIP1.

Brand: Abnova H00022976-A01.50uL

Product Code. 16104316

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene is a member of the paired box (PAX) gene family and encodes a nuclear protein with six BRCT (breast cancer carboxy-terminal) domains. This protein plays a critical role in maintaining genome stability, condensation of chromatin and progression through mitosis. [provided by RefSeq

Sequence: HLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSF

Specifications

Antigen	PAXIP1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant PAXIP1.
Gene	PAXIP1
Gene Alias	CAGF28/CAGF29/FLJ41049/PACIP1/PAXIP1L/PTIP/TNRC2
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_007349
Gene Symbols	PAXIP1
Immunogen	PAXIP1 (NP_620176, 868 a.a. ∽ 975 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	22976
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

PAXIP1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions