missing translation for 'onlineSavingsMsg'
Learn More

PCDH8, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCDH8.

Brand: Abnova H00005100-A01.50uL

Product Code. 16122435

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq

Sequence: VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH

Specifications

Antigen	PCDH8
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant PCDH8.
Gene	PCDH8
Gene Alias	ARCADLIN/PAPC
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Antisera

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_002590
Gene Symbols	PCDH8
Immunogen	PCDH8 (NP_002581, 32 a.a. ∽ 120 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	5100
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

PCDH8, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions