missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16143596

POLS, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16143596
Change view
Click to view available options
Quantity:
50 μL
Conditionnement:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
16143596 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16143596 Fournisseur Abnova Code fournisseur H00011044A01.50uL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse polyclonal antibody raised against a partial recombinant POLS.

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. [provided by RefSeq

Sequence: SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG

Spécification

Antigen POLS
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant POLS.
Formulation 50% glycerol
Gene POLS
Gene Accession No. NM_006999
Gene Alias LAK-1/POLK/TRF4/TRF4-1
Gene Symbols POLS
Host Species Mouse
Immunogen POLS (NP_008930, 2 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11044
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.