missing translation for 'onlineSavingsMsg'
Learn More

PSAT1, Mouse, Clone: 1C2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PSAT1.

Brand: Abnova H00029968-M01A.200uL

Product Code. 16106216

€ 349.00 / 200µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Specifications

Antigen	PSAT1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	ascites with no preservative
Gene Accession No.	NM_058179
Gene Symbols	PSAT1
Immunogen	PSAT1 (NP_478059,262 a.a. ∽ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	29968
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Ascites

Applications	ELISA, Western Blot
Clone	1C2
Description	Mouse monoclonal antibody raised against a partial recombinant PSAT1.
Gene	PSAT1
Gene Alias	EPIP/MGC1460/PSA/PSAT
Host Species	Mouse
Quantity	200 μL
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2b κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

PSAT1, Mouse, Clone: 1C2, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions