missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16149954

RBPJ, Mouse, Clone: 4E12, Abnova™

Product Code. 16149954
Change view
Click to view available options
Quantity:
200 μL
Unit Size:
200µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16149954 200 μL 200µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16149954 Supplier Abnova Supplier No. H00003516M01A.200uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant RBPJ.

Sequence: WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC

Specifications

Antigen RBPJ
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4E12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RBPJ.
Formulation ascites with no preservative
Gene RBPJ
Gene Accession No. NM_203284
Gene Alias CBF1/IGKJRB/IGKJRB1/KBF2/MGC61669/RBP-J/RBPJK/RBPSUH/SUH/csl
Gene Symbols RBPJ
Host Species Mouse
Immunogen RBPJ (NP_976029,3 a.a. ∽ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3516
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.