missing translation for 'onlineSavingsMsg'
Learn More

RETN, Mouse, Clone: 4B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RETN.

Brand: Abnova H00056729-M24A.200uL

Product Code. 16065585

€ 349.00 / 200µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq

Sequence: TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV*

Specifications

Antigen	RETN
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	ascites with no preservative
Gene Accession No.	NM_020415
Gene Symbols	RETN
Immunogen	RETN (NP_065148,20 a.a. ∽ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	56729
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Ascites

Applications	ELISA, Western Blot
Clone	4B11
Description	Mouse monoclonal antibody raised against a partial recombinant RETN.
Gene	RETN
Gene Alias	ADSF/FIZZ3/MGC126603/MGC126609/RETN1/RSTN/XCP1
Host Species	Mouse
Quantity	200 μL
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2a κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

RETN, Mouse, Clone: 4B11, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions