missing translation for 'onlineSavingsMsg'
Learn More

SAMSN1, Mouse, Clone: 1B8, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant SAMSN1.

Brand: Abnova H00064092-M01A.200uL

Product Code. 16163373

€ 349.00 / 200µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM

Sequence: MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD

Specifications

Antigen	SAMSN1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	ascites with no preservative
Gene Accession No.	BC029112
Gene Symbols	SAMSN1
Immunogen	SAMSN1 (AAH29112,1 a.a. ∽ 373 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	64092
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Ascites

Applications	ELISA, Western Blot
Clone	1B8
Description	Mouse monoclonal antibody raised against a full-length recombinant SAMSN1.
Gene	SAMSN1
Gene Alias	HACS1/NASH1/SASH2/SH3D6B
Host Species	Mouse
Quantity	200 μL
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

SAMSN1, Mouse, Clone: 1B8, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions