missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MPPED1 Polyclonal antibody specifically detects MPPED1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | MPPED1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | Adult brain protein 239, C22orf1MGC88045, chromosome 22 open reading frame 1, EC 3.1, FAM1AFLJ78907, FLJ50009, FLJ54633,239ABFLJ59965, metallophosphoesterase domain containing 1, metallophosphoesterase domain-containing protein 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 277-326 of human MPPED1 (NP_001037835.1). PRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?