missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRGX1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | MRGX1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18616012
|
Novus Biologicals
NBP2-94415-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670032
|
Novus Biologicals
NBP2-94415-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRGX1 Polyclonal antibody specifically detects MRGX1 in Mouse, Rat samples. It is validated for Western BlotSpecifications
| MRGX1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 259249 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| G protein-coupled receptor MRGX1, GPCR, MAS-related GPR, member X1, mas-related G-protein coupled receptor member X1, MRGX1G protein-coupled receptor SNSR3, Sensory neuron-specific G-protein coupled receptor 3/4, SNSR3, SNSR4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3). LNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title