missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRP1 Antibody (IU5C1), Alexa Fluor™ 750, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NB110-57131AF750
This item is not returnable.
View return policy
Description
MRP1 Monoclonal antibody specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| MRP1 | |
| Monoclonal | |
| Alexa Fluor 750 | |
| ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein | |
| A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] | |
| 0.1 mL | |
| ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
| 4363 | |
| Store at 4°C in the dark. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| IU5C1 | |
| 50mM Sodium Borate | |
| Mouse | |
| Protein G purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction