missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | MRPL18 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627312
|
Novus Biologicals
NBP2-94040-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653102
|
Novus Biologicals
NBP2-94040-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
MRPL18 Polyclonal antibody specifically detects MRPL18 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceEspecificaciones
| MRPL18 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.3), 50% glycerol | |
| 29074 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| HSPC071,39S ribosomal protein L18, mitochondrial, L18mt, mitochondrial ribosomal protein L18, MRP-L18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human MRPL18 (NP_054880.2). MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto