missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL34 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | MRPL34 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603180
|
Novus Biologicals
NBP2-93040-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626881
|
Novus Biologicals
NBP2-93040-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRPL34 Polyclonal antibody specifically detects MRPL34 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| MRPL34 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 64981 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| L34mtMGC24974, MGC2633, mitochondrial ribosomal protein L34, MRP-L34,39S ribosomal protein L34, mitochondrial | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 16-92 of human MRPL34 (NP_076426.1). AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title