missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL43 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 481.00
Specifications
| Antigen | MRPL43 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693121
|
Novus Biologicals
NBP2-93527-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695790
|
Novus Biologicals
NBP2-93527-0.1ml |
0.1 mL |
€ 481.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRPL43 Polyclonal antibody specifically detects MRPL43 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| MRPL43 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.3), 50% glycerol | |
| 84545 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 39S ribosomal protein L43, mitochondrial, bMRP36a, L43mt, MGC17989, MGC48892, Mitochondrial ribosomal protein bMRP36a, mitochondrial ribosomal protein L43, MRP-L43 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1). LNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title