missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPS10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 509.25
Specifications
| Antigen | MRPS10 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18409100
|
Novus Biologicals
NBP1-83848-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18200866
|
Novus Biologicals
NBP1-83848 |
0.1 mL |
€ 539.00 € 509.25 / 0.10mL Save € 29.75 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRPS10 Polyclonal specifically detects MRPS10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MRPS10 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55173 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 28S ribosomal protein S10, mitochondrial, FLJ10567, mitochondrial 28S ribosomal protein S10, mitochondrial ribosomal protein S10, MRP-S10, PNAS-122, S10mt | |
| MRPS10 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title