missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MS4A6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86541
This item is not returnable.
View return policy
Description
MS4A6A Polyclonal specifically detects MS4A6A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MS4A6A | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MS4A6A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.1mg/mL | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 4SPAN3, CD20 antigen-like 3, CD20L3MS4A6A-polymorph, CD20-like precusor, Four-span transmembrane protein 3, four-span transmembrane protein 3.1,4SPAN3.2, four-span transmembrane protein 3.2, HAIRB-iso, membrane-spanning 4-domains subfamily A member 6A, membrane-spanning 4-domains, subfamily A, member 6A, MGC131944, MGC22650, MS4A6MST090, MSTP090 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64231 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction