missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSH6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | MSH6 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18495850
|
Novus Biologicals
NBP1-83319-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18425880
|
Novus Biologicals
NBP1-83319 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MSH6 Polyclonal antibody specifically detects MSH6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| MSH6 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, DNA Repair, Mismatch Repair | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2956 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DNA mismatch repair protein Msh6, G/T mismatch-binding protein, GTBPHNPCC5, GTMBP, hMSH6, HSAP, mutS (E. coli) homolog 6, mutS homolog 6 (E. coli), MutS-alpha 160 kDa subunit, p160, sperm-associated protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title