missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MT-CO2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 226.00 - € 470.00
Specifications
| Antigen | MT-CO2 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666160
|
Novus Biologicals
NBP2-93084-0.02ml |
0.02 mL |
€ 226.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643470
|
Novus Biologicals
NBP2-93084-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MT-CO2 Polyclonal antibody specifically detects MT-CO2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| MT-CO2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 4513 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-100 of human MT-CO2 (YP_003024029.1). YALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title