missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTUS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | MTUS2 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18255840
|
Novus Biologicals
NBP2-54923 |
100 μL |
€ 572.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18642228
|
Novus Biologicals
NBP2-54923-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MTUS2 Polyclonal specifically detects MTUS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MTUS2 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23281 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEIPSKLEAQLGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCGEAHPEATDALGHLLNSDLHHLGVGRGNCEEKRGVNPGEQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cardiac zipper protein, CAZIPTracking protein of 150 kDa, KIAA0774+TIP of 150 kDa, microtubule associated tumor suppressor candidate 2, Microtubule plus-end tracking protein TIP150, TIP150microtubule-associated tumor suppressor candidate 2 | |
| MTUS2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title