missing translation for 'onlineSavingsMsg'
Learn More

MUC20 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-94455-0.02ml

View more versions of this product

Product Code. 18602932

€ 190.00 / 0.02mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

MUC20 Polyclonal antibody specifically detects MUC20 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen	MUC20
Classification	Polyclonal
Dilution	Western Blot 1:500-1:2000
Gene Alias	FLJ14408, FLJ53153, KIAA1359mucin-20, MUC-20, mucin 20, cell surface associated, transmembrane mucin MUC20S
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3). PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
Quantity	0.02 mL
Research Discipline	Cell Biology, Cytoskeleton Markers, Signal Transduction
Gene ID (Entrez)	200958
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Übermitteln Sie eine inhaltliche Korrektur

MUC20 Antibody - Azide and BSA Free, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions