missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MUL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-59068
This item is not returnable.
View return policy
Description
MUL1 Polyclonal specifically detects MUL1 in Human, Mouse samples. It is validated for Western Blot.
Specifications
| MUL1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C1orf166mitochondrial E3 ubiquitin ligase 1, E3 ubiquitin-protein ligase MUL1, EC 6.3.2, EC 6.3.2.-, FLJ12875, GIDERP11-401M16.2, Growth inhibition and death E3 ligase, MAPLE3 ubiquitin ligase, mitochondrial E3 ubiquitin protein ligase 1, mitochondrial ubiquitin ligase activator of NF-kB, mitochondrial ubiquitin ligase activator of NFKB 1, Mitochondrial-anchored protein ligase, MULANchromosome 1 open reading frame 166, Putative NF-kappa-B-activating protein 266, RING finger protein 218, RNF218mitochondria-anchored protein ligase | |
| Rabbit | |
| 40 kDa | |
| 100 μL | |
| Signal Transduction | |
| 79594 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q969V5 | |
| MUL1 | |
| Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Crab-eating macaque (100%), Giant panda (92%). | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction