missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Musashi-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21216-25ul
This item is not returnable.
View return policy
Description
Musashi-1 Polyclonal antibody specifically detects Musashi-1 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Musashi-1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Musashi (Drosophila) homolog 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA | |
| 25 μg | |
| Cancer, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells | |
| 4440 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction