missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93968-0.02ml
This item is not returnable.
View return policy
Description
Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal antibody specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Muscarinic Acetylcholine Receptor M1/CHRM1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-460 of human Muscarinic Acetylcholine Receptor M1/CHRM1 (NP_000729.2). WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC | |
| 0.02 mL | |
| Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators | |
| 1128 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction