missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin PLP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35912-100ul
This item is not returnable.
View return policy
Description
Myelin PLP Polyclonal antibody specifically detects Myelin PLP in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| Myelin PLP | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human Myelin PLP (NP_000524.3).,, Sequence:, GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD | |
| 100 μL | |
| Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers | |
| 5354 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction