missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYLK3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 470.00
Specifications
| Antigen | MYLK3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18658100
|
Novus Biologicals
NBP2-93604-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643760
|
Novus Biologicals
NBP2-93604-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYLK3 Polyclonal antibody specifically detects MYLK3 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| MYLK3 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 91807 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| caMLCK, Cardiac-MyBP-C-associated Ca/CaM kinase, EC 2.7.11, EC 2.7.11.18, MGC126319, MGC126320, MLC kinase, MLCK2, MLCKcardiac-MyBP-C associated Ca/CaM kinase, myosin light chain kinase 3, putative myosin light chain kinase 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2). MQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title