missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYO18A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 470.00
Specifications
| Antigen | MYO18A |
|---|---|
| Dilution | Western Blot 1:1000-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693131
|
Novus Biologicals
NBP2-93035-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683550
|
Novus Biologicals
NBP2-93035-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYO18A Polyclonal antibody specifically detects MYO18A in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| MYO18A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 399687 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| KIAA0216DKFZp686L0243, MAJN, Molecule associated with JAK3 N-terminus, myosin 18A, Myosin containing a PDZ domain, myosin containing PDZ domain, myosin XVIIIA, myosin-XVIIIa, MYSPDZ, SP-A receptor subunit SP-R210 alphaS, SPR210 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2). SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title