missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MYSM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | MYSM1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18264903
|
Novus Biologicals
NBP2-57859 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18659596
|
Novus Biologicals
NBP2-57859-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MYSM1 Polyclonal specifically detects MYSM1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MYSM1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 114803 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQLAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DKFZp779J1554, DKFZp779J1721,2A-DUB, histone H2A deubiquitinase MYSM1, KIAA1915, Myb-like, SWIRM and MPN domains 1,2ADUB, RP4-592A1.1, SWIRM and MPN domain-containing protein 1 | |
| MYSM1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title