missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N4BP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 370.00 - € 529.00
Specifications
| Antigen | N4BP2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18214103
|
Novus Biologicals
NBP2-59017 |
100 μL |
€ 529.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606088
|
Novus Biologicals
NBP2-59017-25ul |
25 μL |
€ 370.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
N4BP2 Polyclonal specifically detects N4BP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| N4BP2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55728 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSDSLAQREHRSRMPKTGLSEPNLEIGTNDKMNEISLSTAHEACWGTSSQKLKTLGSSNLGSSEMLLSEMTCESQTCLSKKSHGQHT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| B3BPKIAA1413, BCL-3-binding protein, EC 3.-, FLJ10680, NEDD4 binding protein 2, NEDD4-binding protein 2 | |
| N4BP2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title