missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16384685

Invitrogen™ NAA15 Polyclonal Antibody
GREENER_CHOICE

Product Code. 16384685 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16384685 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16384685 Supplier Invitrogen™ Supplier No. PA595421

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: 293T whole cell. IHC: mouse intestine tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NAA15
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene NAA15
Gene Accession No. Q80UM3, Q9BXJ9
Gene Alias 5730450D16Rik; 6330400I15; ASTBDN; GA19; gastric cancer antigen Ga19; mNAT1; N(alpha)-acetyltransferase 15, NatA auxiliary subunit; Naa15; N-alpha-acetyltransferase 15, NatA auxiliary subunit; NARG1; NAT1P; NATH; NMDA receptor regulated 1; NMDA receptor-regulated gene 1; NMDA receptor-regulated protein 1; N-terminal acetyltransferase; N-terminal acetyltransferase 1; N-terminal aceyltransferase 1; Protein tubedown-1; TBDN; Tbdn-1; TBDN100; transcriptional coactivator tubedown-100; tubedown; tubedown-1
Gene Symbols NAA15
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 74838, 80155
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.