missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAPRT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 539.00
Specifications
| Antigen | NAPRT1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463971
|
Novus Biologicals
NBP1-87244-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18204607
|
Novus Biologicals
NBP1-87244 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAPRT1 Polyclonal specifically detects NAPRT1 in Human, Mouse, Chinese Hamster samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NAPRT1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856 | |
| NAPRT1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human NAPRT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Chinese Hamster | |
| Q6XQN6 | |
| 93100 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 57 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title