missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NBPF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46710-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
NBPF4 Polyclonal antibody specifically detects NBPF4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| NBPF4 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| cDNA, FLJ79337, weakly similar to Homo sapiens phosphodiesterase 4D interacting protein, transcript variant 1, mRNA, NBPF4, Neuroblastoma breakpoint family member 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RLSQELPEVKEQEVPEDSVNEVYLTPSVHHDVSDCHQPYSSTLSSLEDQLACSALDVASPTEAACPQGTWSGDLSHH | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 148545 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu