missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NCBP1 Polyclonal antibody specifically detects NCBP1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | NCBP1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | DyLight 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CBP80nuclear cap binding protein subunit 1, 80kD, NCBP 80 kDa subunit, NCBPMGC2087, nuclear cap binding protein subunit 1, 80kDa, nuclear cap-binding protein subunit 1,80 kDa nuclear cap-binding protein, Sto1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCBP1 (NP_002477.1).,, Sequence:, MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?