missing translation for 'onlineSavingsMsg'
Learn More

NCF4 Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30493609 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30493609 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30493609 Supplier Novus Biologicals Supplier No. NBP337904FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NCF4 Polyclonal antibody specifically detects NCF4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NCF4
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-190 of human NCF4 (NP_038202.2).,, Sequence:, EIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4689
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.