missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NCKAP1 Polyclonal specifically detects NCKAP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
| Gene Symbols | NCKAP1 |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY |
| Purification Method | Affinity Purified |
| Quantity | 0.1 mL |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?