missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C16orf96 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91124-25ul
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
C16orf96 Polyclonal specifically detects C16orf96 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
| C16orf96 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AC023830.1, chromosome 16 open reading frame 96, hypothetical protein LOC342346 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 342346 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C16ORF96 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMK | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion